SZRD1 Antibody

Name SZRD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57737
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB ICC/IF
Species Reactivities Human, Dog
Antigen Synthetic peptides corresponding to C1orf144 (chromosome 1 open reading frame 144) The peptide sequence was selected from the N terminal of C1orf144)(50ug). Peptide sequence MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SZRD1
Supplier Page Shop

Product images