SMPDL3B Antibody
| Name | SMPDL3B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57912 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SMPDL3B (sphingomyelin phosphodiesterase, acid-like 3B) The peptide sequence was selected from the N terminal of SMPDL3B. Peptide sequence ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SMPDL3B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SMPDL3B Antibody [NBP1-57912] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29826_SMPDL3B-Antibody-Western-Blot-NBP1-57912-img0004.jpg)
![Immunohistochemistry: SMPDL3B Antibody [NBP1-57912] - Human Intestine](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29827_SMPDL3B-Antibody-Immunohistochemistry-NBP1-57912-img0003.jpg)
![Western Blot: SMPDL3B Antibody [NBP1-57912] - Raji cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29828_SMPDL3B-Antibody-Western-Blot-NBP1-57912-img0001.jpg)