PYCR1 Antibody
| Name | PYCR1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57934 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PYCR1(pyrroline-5-carboxylate reductase 1) The peptide sequence was selected from the middle region of PYCR1. Peptide sequence RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PYCR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PYCR1 Antibody [NBP1-57934] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24451_PYCR1-Antibody-Western-Blot-NBP1-57934-img0005.jpg)
![Western Blot: PYCR1 Antibody [NBP1-57934] - Human fibroblast, concentration 3.3 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24452_PYCR1-Antibody-Western-Blot-NBP1-57934-img0004.jpg)
![Western Blot: PYCR1 Antibody [NBP1-57934] - 293T cells lysate, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24453_PYCR1-Antibody-Western-Blot-NBP1-57934-img0003.jpg)