RBM14 Antibody
| Name | RBM14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58264 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Bovine, Dog, Rabbit |
| Antigen | Synthetic peptides corresponding to RBM14(RNA binding motif protein 14) The peptide sequence was selected from the N terminal of RBM14. Peptide sequence NVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFG. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RBM14 |
| Supplier Page | Shop |
Product images
![Western Blot: RBM14 Antibody [NBP1-58264] - Sample Type: 2. mouse brain extracts (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience Secondary Antibody Dilution: 1: 20,000](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9797_RBM14%2520Antibody-Western%2520Blot-NBP1-58264-img0004.jpg)
Western Blot: RBM14 Antibody [NBP1-58264] - Sample Type: 2. mouse brain extracts (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience Secondary Antibody Dilution: 1: 20,000
![Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-58264] - Mouse brain stem cells, 2 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9798_RBM14%2520Antibody-Immunohistochemistry-Paraffin-NBP1-58264-img0003.jpg)
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-58264] - Mouse brain stem cells, 2 ug/ml.
![Western Blot: RBM14 Antibody [NBP1-58264] - Mouse Brain lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9799_RBM14%2520Antibody-Western%2520Blot-NBP1-58264-img0002.jpg)
Western Blot: RBM14 Antibody [NBP1-58264] - Mouse Brain lysate, Antibody Titration: 0.2-1 ug/ml