KIF13B Antibody
| Name | KIF13B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58258 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to KIF13B(kinesin family member 13B) The peptide sequence was selected from the N terminal of KIF13B. Peptide sequence SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KIF13B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: KIF13B Antibody [NBP1-58258] - HepG2 cell lysate, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29947_KIF13B-Antibody-Western-Blot-NBP1-58258-img0002.jpg)
Western Blot: KIF13B Antibody [NBP1-58258] - HepG2 cell lysate, concentration 1 ug/ml.
![Immunohistochemistry: KIF13B Antibody [NBP1-58258] - Paraffin Embedded Tissue: Human Prostate Antibody Concentration: 5 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29948_KIF13B-Antibody-Immunohistochemistry-NBP1-58258-img0005.jpg)
Immunohistochemistry: KIF13B Antibody [NBP1-58258] - Paraffin Embedded Tissue: Human Prostate Antibody Concentration: 5 ug/ml
![Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-58258] - Human prostate cell lysate tissue at an antibody concentration of 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29949_KIF13B-Antibody-Immunohistochemistry-Paraffin-NBP1-58258-img0004.jpg)
Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-58258] - Human prostate cell lysate tissue at an antibody concentration of 5.0ug/ml.