RBMS1 Antibody
| Name | RBMS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58231 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RBMS1 (RNA binding motif, single stranded interacting protein 1) The peptide sequence was selected from the C terminal of RBMS1. Peptide sequence TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | RBMS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RBMS1 Antibody [NBP1-58231] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14515_RBMS1-Antibody-Western-Blot-NBP1-58231-img0003.jpg)
![Immunohistochemistry-Paraffin: RBMS1 Antibody [NBP1-58231] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14516_RBMS1-Antibody-Immunohistochemistry-Paraffin-NBP1-58231-img0002.jpg)