Name | Dishevelled-1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58317 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to DVL1(dishevelled, dsh homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of DVL1. Peptide sequence LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | DVL1P1 |
Conjugate | Unconjugated |
Supplier Page | Shop |