Dishevelled-1 Antibody

Name Dishevelled-1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58317
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to DVL1(dishevelled, dsh homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of DVL1. Peptide sequence LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene DVL1P1
Conjugate Unconjugated
Supplier Page Shop

Product images