PEX3 Antibody
| Name | PEX3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52960 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PEX3(peroxisomal biogenesis factor 3) The peptide sequence was selected from the N terminal of PEX3. Peptide sequence KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | PEX3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PEX3 Antibody [NBP1-52960] - Titration: 5.0ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24761_PEX3-Antibody-Western-Blot-NBP1-52960-img0004.jpg)
![Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-52960] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24762_PEX3-Antibody-Immunohistochemistry-Paraffin-NBP1-52960-img0003.jpg)