GTPBP10 Antibody
| Name | GTPBP10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52959 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GTPBP10(GTP-binding protein 10 (putative)) The peptide sequence was selected from the middle region of GTPBP10. Peptide sequence IILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GTPBP10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GTPBP10 Antibody [NBP1-52959] - Titration: 1 ug/ml Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24763_GTPBP10-Antibody-Western-Blot-NBP1-52959-img0003.jpg)
![Immunohistochemistry-Paraffin: GTPBP10 Antibody [NBP1-52959] - Human Placenta Tissue, 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24764_GTPBP10-Antibody-Immunohistochemistry-Paraffin-NBP1-52959-img0002.jpg)