BMP2K Antibody
| Name | BMP2K Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52901 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to BMP2K(BMP2 inducible kinase) The peptide sequence was selected from the C terminal of BMP2K. Peptide sequence AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | BMP2K |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: BMP2K Antibody [NBP1-52901] - HepG2 cell lysate, concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24836_BMP2K-Antibody-Western-Blot-NBP1-52901-img0001.jpg)
![Immunohistochemistry-Paraffin: BMP2K Antibody [NBP1-52901] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24837_BMP2K-Antibody-Immunohistochemistry-Paraffin-NBP1-52901-img0002.jpg)