CTP synthase Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-52892
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CTPS(CTP synthase) The peptide sequence was selected from the N terminal of CTPS. Peptide sequence SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: CTPS1
• Conjugate: Unconjugated

Product images

Western Blot: CTP synthase Antibody [NBP1-52892] - Lanes: 1 : 45ug human capan1 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: CTPS.

Immunohistochemistry-Paraffin: CTP synthase Antibody [NBP1-52892] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Western Blot: CTP synthase Antibody [NBP1-52892] - 721B tissue lysate at a concentration of 5ug/ml.