Histidase Antibody

Name Histidase Antibody
Supplier Novus Biologicals
Catalog NBP1-53135
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to HAL(histidine ammonia-lyase) The peptide sequence was selected from the N terminal of HAL. Peptide sequence INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HAL
Conjugate Unconjugated
Supplier Page Shop

Product images