ACADVL Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54378
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ACADVL(acyl-Coenzyme A dehydrogenase, very long chain) The peptide sequence was selected from the N terminal of ACADVL (NP_001029031). Peptide sequence RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ACADVL
• Conjugate: Unconjugated

Product images

Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Immunocytochemistry/Immunofluorescence: ACADVL Antibody [NBP1-54378] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes; Primary Antibody Concentration: 1:100

Western Blot: ACADVL Antibody [NBP1-54378] - Lanes: 1 : Normal controls Normal enzyme expression 2: Normal controls Normal enzyme expression 3: Positive mutants Defective enzyme expression 4: Positive mutants Defective enzyme expression 5: Positive mutants Defective enzyme expression Primary Antibody Dilution: 1 : 2000 Secondary Antibody: Secondary Antibody Dilution: 1 : 1000 Gene name: ACADVL Submitted by: David Lombert, Medical College of Wisconsin.

Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml ACADVL is supported by BioGPS gene expression data to be expressed in HeLa

Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml

Western Blot: ACADVL Antibody [NBP1-54378] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: HepG2 cell lysate ACADVL is supported by BioGPS gene expression data to be expressed in HepG2