PPP2R3A Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54581
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PPP2R3A(protein phosphatase 2 (formerly 2A), regulatory subunit B'', alpha) The peptide sequence was selected from the N terminal of PPP2R3A. Peptide sequence SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDN
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PPP2R3A
• Conjugate: Unconjugated