DIS3L2 Antibody
| Name | DIS3L2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80480 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human MGC42174. Peptide sequence: MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIF |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | DIS3L2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DIS3L2 Antibody [NBP1-80480] - Titration: 1.25ug/ml Positive Control: Human Muscle.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24575_DIS3L2-Antibody-Western-Blot-NBP1-80480-img0003.jpg)
Western Blot: DIS3L2 Antibody [NBP1-80480] - Titration: 1.25ug/ml Positive Control: Human Muscle.
![Immunohistochemistry-Paraffin: DIS3L2 Antibody [NBP1-80480] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24576_DIS3L2-Antibody-Immunohistochemistry-Paraffin-NBP1-80480-img0002.jpg)
Immunohistochemistry-Paraffin: DIS3L2 Antibody [NBP1-80480] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.