Name | RBM4B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-80469 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the C terminal of human RBM4B. Peptide sequence AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | RBM4B |
Conjugate | Unconjugated |
Supplier Page | Shop |