NOC4L Antibody
| Name | NOC4L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80464 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human NOC4L. Peptide sequence CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NOC4L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NOC4L Antibody [NBP1-80464] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29717_NOC4L-Antibody-Western-Blot-NBP1-80464-img0001.jpg)
Western Blot: NOC4L Antibody [NBP1-80464] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: NOC4L Antibody [NBP1-80464] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29718_NOC4L-Antibody-Immunohistochemistry-Paraffin-NBP1-80464-img0003.jpg)
Immunohistochemistry-Paraffin: NOC4L Antibody [NBP1-80464] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.