MTHFSD Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-80462
• Prices: $139.00, $299.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the N terminal of human MTHFSD. Peptide sequence EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: MTHFSD
• Conjugate: Unconjugated