FAM55D Antibody
| Name | FAM55D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80545 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Guinea Pig |
| Antigen | Synthetic peptide directed towards the C terminal of human FAM55D. Peptide sequence TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | NXPE4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FAM55D Antibody [NBP1-80545] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24492_FAM55D-Antibody-Western-Blot-NBP1-80545-img0001.jpg)
Western Blot: FAM55D Antibody [NBP1-80545] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml
![Immunohistochemistry-Paraffin: FAM55D Antibody [NBP1-80545] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24493_FAM55D-Antibody-Immunohistochemistry-Paraffin-NBP1-80545-img0002.jpg)
Immunohistochemistry-Paraffin: FAM55D Antibody [NBP1-80545] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.