SP140 Antibody
| Name | SP140 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80009 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human SP140. Peptide sequence PEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNL. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SP140 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SP140 Antibody [NBP1-80009] - Human Lung Tumor, Antibody Dilution: 0.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14589_SP140%2520Antibody-Western%2520Blot-NBP1-80009-img0005.jpg)
Western Blot: SP140 Antibody [NBP1-80009] - Human Lung Tumor, Antibody Dilution: 0.5 ug/ml.
![Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-80009] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14590_SP140-Antibody-Immunohistochemistry-Paraffin-NBP1-80009-img0003.jpg)
Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-80009] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
![Western Blot: SP140 Antibody [NBP1-80009] - Raji Cell Lysate 5.0 ug/ml, gel concentration 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14591_SP140-Antibody-Western-Blot-NBP1-80009-img0004.jpg)
Western Blot: SP140 Antibody [NBP1-80009] - Raji Cell Lysate 5.0 ug/ml, gel concentration 12%