Name | Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-80446 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the N terminal of human RP11-78J21. 1. Peptide sequence MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | HNRNPA1L2 |
Conjugate | Unconjugated |
Supplier Page | Shop |