Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody

Name Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody
Supplier Novus Biologicals
Catalog NBP1-80446
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human RP11-78J21. 1. Peptide sequence MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HNRNPA1L2
Conjugate Unconjugated
Supplier Page Shop

Product images