ENT2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69313
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC29A2(solute carrier family 29 (nucleoside transporters), member 2) The peptide sequence was selected from the C terminal of SLC29A2. Peptide sequence PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC29A2
• Conjugate: Unconjugated

Product images

Western Blot: ENT2 Antibody [NBP1-69313] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml

Western Blot: ENT2 Antibody [NBP1-69313] - This Anti-SLC29A2 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.

Western Blot: ENT2 Antibody [NBP1-69313] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Western Blot: ENT2 Antibody [NBP1-69313] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Western Blot: ENT2 Antibody [NBP1-69313] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.