ST3GAL4 Antibody
| Name | ST3GAL4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69565 |
| Prices | $329.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ST3GAL4(ST3 beta-galactoside alpha-2,3-sialyltransferase 4) The peptide sequence was selected from the middle region of ST3GAL4. Peptide sequence FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ST3GAL4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ST3GAL4 Antibody [NBP1-69565] - This Anti-ST3GAL4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14652_ST3GAL4-Antibody-Western-Blot-NBP1-69565-img0001.jpg)
![Immunohistochemistry: ST3GAL4 Antibody [NBP1-69565] - Human Liver cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14653_ST3GAL4-Antibody-Immunohistochemistry-NBP1-69565-img0002.jpg)