GALNT6 Antibody
| Name | GALNT6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69641 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GALNT6(UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6) The peptide sequence was selected from the N terminal of GALNT6. Peptide sequence MNNLRDSMPKLQIRAPEAQQTLFSINQSCL |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | GALNT6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GALNT6 Antibody [NBP1-69641] - This Anti-GALNT6 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24310_GALNT6-Antibody-Western-Blot-NBP1-69641-img0001.jpg)
![Immunohistochemistry: GALNT6 Antibody [NBP1-69641] - Human kidney.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24311_GALNT6-Antibody-Immunohistochemistry-NBP1-69641-img0002.jpg)