Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody
| Name | Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62542 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CHST1(carbohydrate (keratan sulfate Gal-6) sulfotransferase 1) The peptide sequence was selected from the N terminal of CHST1. Peptide sequence SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CHST1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62542] - Jurkat tissue lysate at a concentration of 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24398_Carbohydrate-Sulfotransferase-1-CHST1-KS6ST-Antibody-Western-Blot-NBP1-62542-img0001.jpg)
Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62542] - Jurkat tissue lysate at a concentration of 1.25ug/ml.
![Immunohistochemistry-Paraffin: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62542] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24399_Carbohydrate-Sulfotransferase-1-CHST1-KS6ST-Antibody-Immunohistochemistry-Paraffin-NBP1-62542-img0003.jpg)
Immunohistochemistry-Paraffin: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62542] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.