MBOAT7 Antibody

Name MBOAT7 Antibody
Supplier Novus Biologicals
Catalog NBP1-62511
Prices $369.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LENG4 The peptide sequence was selected from the C terminal of LENG4 (NM_024298). Peptide sequence WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MBOAT7
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.