NETO2 Antibody
| Name | NETO2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62591 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NETO2(neuropilin (NRP) and tolloid (TLL)-like 2) The peptide sequence was selected from the N terminal of NETO2. Peptide sequence ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NETO2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: NETO2 Antibody [NBP1-62591] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14526_NETO2-Antibody-Western-Blot-NBP1-62591-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: NETO2 Antibody [NBP1-62591] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14527_NETO2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-62591-img0003.jpg)