Name | Hyaluronan Synthase 3/HAS3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62551 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the N terminal of human HAS3 (NP_005320). Peptide sequence GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVD. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | HAS3 |
Conjugate | Unconjugated |
Supplier Page | Shop |