Hyaluronan Synthase 3/HAS3 Antibody
| Name | Hyaluronan Synthase 3/HAS3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62551 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human HAS3 (NP_005320). Peptide sequence GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HAS3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-62551] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15832_Hyaluronan-Synthase-3-HAS3-Antibody-Western-Blot-NBP1-62551-img0004.jpg)
Western Blot: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-62551] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.