PIPPIN Antibody
| Name | PIPPIN Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70673 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CSDC2 (cold shock domain containing C2, RNA binding) The peptide sequence was selected from the N terminal of CSDC2. Peptide sequence MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CSDC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PIPPIN Antibody [NBP1-70673] - Titration: 0.625ug/ml, Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24857_PIPPIN-Antibody-Western-Blot-NBP1-70673-img0005.jpg)
![Immunohistochemistry-Paraffin: PIPPIN Antibody [NBP1-70673] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24858_PIPPIN-Antibody-Immunohistochemistry-Paraffin-NBP1-70673-img0004.jpg)