COBLL1 Antibody

Name COBLL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70504
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to COBLL1(COBL-like 1) The peptide sequence was selected from the N terminal of COBLL1 (NM_014900). Peptide sequence SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene COBLL1
Conjugate Unconjugated
Supplier Page Shop

Product images