COBLL1 Antibody
| Name | COBLL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70504 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to COBLL1(COBL-like 1) The peptide sequence was selected from the N terminal of COBLL1 (NM_014900). Peptide sequence SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | COBLL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: COBLL1 Antibody [NBP1-70504] - Titration: 0.5ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24524_COBLL1-Antibody-Western-Blot-NBP1-70504-img0004.jpg)
Western Blot: COBLL1 Antibody [NBP1-70504] - Titration: 0.5ug/ml Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: COBLL1 Antibody [NBP1-70504] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24525_COBLL1-Antibody-Immunohistochemistry-Paraffin-NBP1-70504-img0005.jpg)
Immunohistochemistry-Paraffin: COBLL1 Antibody [NBP1-70504] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.