SARDH Antibody
| Name | SARDH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70769 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SARDH(sarcosine dehydrogenase) The peptide sequence was selected from the middle region of SARDH. Peptide sequence DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SARDH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SARDH Antibody [NBP1-70769] - Titration: 2.5 ug/ml, Gel concentration:12%, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24867_SARDH-Antibody-Western-Blot-NBP1-70769-img0003.jpg)
Western Blot: SARDH Antibody [NBP1-70769] - Titration: 2.5 ug/ml, Gel concentration:12%, Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: SARDH Antibody [NBP1-70769] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24868_SARDH-Antibody-Immunohistochemistry-Paraffin-NBP1-70769-img0002.jpg)
Immunohistochemistry-Paraffin: SARDH Antibody [NBP1-70769] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.