Lysyl Oxidase Homolog 3/LOXL3 Antibody
| Name | Lysyl Oxidase Homolog 3/LOXL3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79803 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit |
| Antigen | Synthetic peptide directed towards the middle region of human LOXL3The immunogen for this antibody is LOXL3. Peptide sequence AASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWD. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LOXL3 |
| Supplier Page | Shop |
Product images
![Western Blot: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-79803] - Human Placenta lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9999_Lysyl-Oxidase-Homolog-3-LOXL3-Antibody-Western-Blot-NBP1-79803-img0003.jpg)
Western Blot: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-79803] - Human Placenta lysate, concentration 0.2-1 ug/ml.