ZNF81 Antibody

Name ZNF81 Antibody
Supplier Novus Biologicals
Catalog NBP1-79990
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human ZNF81. Peptide sequence QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGDKPYKCSDCGKGFTQK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ZNF81
Conjugate Unconjugated
Supplier Page Shop

Product images