RAB14 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-79962
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Monkey
• Antigen: Synthetic peptide directed towards the C terminal of human RAB14The immunogen for this antibody is RAB14. Peptide sequence FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: RAB14
• Conjugate: Unconjugated

Product images

Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Western Blot: RAB14 Antibody [NBP1-79962] - 1. Human Cervical Cancer Cell Lysate (15ug) 2. Monkey Fibroblast Cell Lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab14-GFP (15ug) at 1:1000.

Western Blot: RAB14 Antibody [NBP1-79962] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%