LAPTM4B Antibody
| Name | LAPTM4B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59416 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human, Mouse, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to LAPTM4B(lysosomal associated protein transmembrane 4 beta) The peptide sequence was selected from the middle region of LAPTM4B. Peptide sequence YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LAPTM4B |
| Supplier Page | Shop |
Product images
![Western Blot: LAPTM4B Antibody [NBP1-59416] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10027_LAPTM4B-Antibody-Western-Blot-NBP1-59416-img0003.jpg)
Western Blot: LAPTM4B Antibody [NBP1-59416] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.
![Immunocytochemistry/Immunofluorescence: LAPTM4B Antibody [NBP1-59416] - Antibodyn Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Membrane and cytoplasmic in processes of pinealocytes and intersticial cells](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10028_LAPTM4B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-59416-img0004.jpg)
Immunocytochemistry/Immunofluorescence: LAPTM4B Antibody [NBP1-59416] - Antibodyn Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Membrane and cytoplasmic in processes of pinealocytes and intersticial cells