Name | CLN6 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59415 |
Prices | $369.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB ICC/IF |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CLN6(ceroid-lipofuscinosis, neuronal 6, late infantile, variant) The peptide sequence was selected from the C terminal of CLN6 (NP_060352). Peptide sequence RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CLN6 |
Conjugate | Unconjugated |
Supplier Page | Shop |