CLN6 Antibody

Name CLN6 Antibody
Supplier Novus Biologicals
Catalog NBP1-59415
Prices $369.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB ICC/IF
Species Reactivities Human
Antigen Synthetic peptides corresponding to CLN6(ceroid-lipofuscinosis, neuronal 6, late infantile, variant) The peptide sequence was selected from the C terminal of CLN6 (NP_060352). Peptide sequence RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLN6
Conjugate Unconjugated
Supplier Page Shop

Product images