SLC37A4 Antibody
| Name | SLC37A4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59400 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Rabbit |
| Antigen | Synthetic peptides corresponding to SLC37A4(solute carrier family 37 (glucose-6-phosphate transporter), member 4) The peptide sequence was selected from the middle region of SLC37A4. Peptide sequence VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTL |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC37A4 |
| Supplier Page | Shop |
Product images
![Western Blot: SLC37A4 Antibody [NBP1-59400] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10031_SLC37A4-Antibody-Western-Blot-NBP1-59400-img0002.jpg)
Western Blot: SLC37A4 Antibody [NBP1-59400] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.
![Immunocytochemistry/Immunofluorescence: SLC37A4 Antibody [NBP1-59400] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, weak signal, low tissue distribution; Primary Antibody Concentration: 1:100](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10032_SLC37A4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-59400-img0003.jpg)
Immunocytochemistry/Immunofluorescence: SLC37A4 Antibody [NBP1-59400] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, weak signal, low tissue distribution; Primary Antibody Concentration: 1:100