MCTP1 Antibody
| Name | MCTP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59355 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MCTP1(multiple C2 domains, transmembrane 1) The peptide sequence was selected from the middle region of MCTP1. Peptide sequence LVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQELKPDPSHSP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MCTP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MCTP1 Antibody [NBP1-59355] - Hela tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14626_MCTP1-Antibody-Western-Blot-NBP1-59355-img0001.jpg)
Western Blot: MCTP1 Antibody [NBP1-59355] - Hela tissue lysate at a concentration of 1ug/ml.
![Immunohistochemistry-Paraffin: MCTP1 Antibody [NBP1-59355] - Human Spleen Tissue, 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14627_MCTP1-Antibody-Immunohistochemistry-Paraffin-NBP1-59355-img0002.jpg)
Immunohistochemistry-Paraffin: MCTP1 Antibody [NBP1-59355] - Human Spleen Tissue, 5 ug/ml.
![Immunohistochemistry: MCTP1 Antibody [NBP1-59355] - Analysis of human spleen after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14628_MCTP1%2520Antibody-Immunohistochemistry-NBP1-59355-img0003.jpg)
Immunohistochemistry: MCTP1 Antibody [NBP1-59355] - Analysis of human spleen after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.