| Name | GGCX Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59394 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GGCX(gamma-glutamyl carboxylase) The peptide sequence was selected from the middle region of GGCX. Peptide sequence FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GGCX |
| Conjugate | Unconjugated |
| Supplier Page | Shop |