Name | GGCX Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59394 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ICC/IF |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to GGCX(gamma-glutamyl carboxylase) The peptide sequence was selected from the middle region of GGCX. Peptide sequence FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | GGCX |
Conjugate | Unconjugated |
Supplier Page | Shop |