Name | MARVELD3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59494 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to MARVELD3(MARVEL domain containing 3) The peptide sequence was selected from the middle region of MARVELD3. Peptide sequence SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | MARVELD3 |
Conjugate | Unconjugated |
Supplier Page | Shop |