MARVELD3 Antibody

Name MARVELD3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59494
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to MARVELD3(MARVEL domain containing 3) The peptide sequence was selected from the middle region of MARVELD3. Peptide sequence SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MARVELD3
Conjugate Unconjugated
Supplier Page Shop

Product images