Monoamine Oxidase B Antibody
| Name | Monoamine Oxidase B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59569 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MAOB(monoamine oxidase B) The peptide sequence was selected from the N terminal of MAOB. Peptide sequence RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MAOB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Monoamine Oxidase B Antibody [NBP1-59569] - Human heart.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14646_Monoamine-Oxidase-B-Antibody-Western-Blot-NBP1-59569-img0006.jpg)
![Immunohistochemistry-Paraffin: Monoamine Oxidase B Antibody [NBP1-59569] - Human Liver tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14647_Monoamine-Oxidase-B-Antibody-Immunohistochemistry-Paraffin-NBP1-59569-img0005.jpg)