SLC25A38 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59559
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC25A38(solute carrier family 25, member 38) The peptide sequence was selected from the middle region of SLC25A38. Peptide sequence VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC25A38
• Conjugate: Unconjugated