COX10 Antibody
| Name | COX10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59554 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to COX10(COX10 homolog, cytochrome c oxidase assembly protein, heme A) The peptide sequence was selected from the middle region of COX10. Peptide sequence APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | COX10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: COX10 Antibody [NBP1-59554] - Middle region validated by WB using mouse mitochondria at 1:1000.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19470_COX10%2520Antibody-Western%2520Blot-NBP1-59554-img0003.jpg)
Western Blot: COX10 Antibody [NBP1-59554] - Middle region validated by WB using mouse mitochondria at 1:1000.
![Western Blot: COX10 Antibody [NBP1-59554] - This Anti-COX10 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19471_COX10%2520Antibody-Western%2520Blot-NBP1-59554-img0001.jpg)
Western Blot: COX10 Antibody [NBP1-59554] - This Anti-COX10 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.
![Western Blot: COX10 Antibody [NBP1-59554] - Middle region validated by WB using mouse mitochondria at 1:1000.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19472_COX10%2520Antibody-Western%2520Blot-NBP1-59554-img0002.jpg)
Western Blot: COX10 Antibody [NBP1-59554] - Middle region validated by WB using mouse mitochondria at 1:1000.