Reticulon 2 Antibody
| Name | Reticulon 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59662 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RTN2(reticulon 2) The peptide sequence was selected from the N terminal of RTN2. Peptide sequence MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | RTN2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Reticulon 2 Antibody [NBP1-59662] - Jurkat cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24396_Reticulon-2-Antibody-Western-Blot-NBP1-59662-img0001.jpg)
![Immunohistochemistry-Paraffin: Reticulon 2 Antibody [NBP1-59662] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24397_Reticulon-2-Antibody-Immunohistochemistry-Paraffin-NBP1-59662-img0003.jpg)