FKTN Antibody
| Name | FKTN Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59640 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit |
| Antigen | Synthetic peptides corresponding to FKTN The peptide sequence was selected from the N terminal of FKTN. Peptide sequence TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | FKTN |
| Supplier Page | Shop |
![Western Blot: FKTN Antibody [NBP1-59640] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10065_FKTN%2520Antibody-Western%2520Blot-NBP1-59640-img0001.jpg)
![Immunohistochemistry-Paraffin: FKTN Antibody [NBP1-59640] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/10066_FKTN%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59640-img0003.jpg)