PGLS Antibody
| Name | PGLS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56387 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PGLS(6-phosphogluconolactonase) The peptide sequence was selected from the middle region of PGLS. Peptide sequence AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PGLS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PGLS Antibody [NBP1-56387] - 721_B tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14382_PGLS-Antibody-Western-Blot-NBP1-56387-img0001.jpg)
![Immunohistochemistry: PGLS Antibody [NBP1-56387] - Human Tonsil.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14383_PGLS-Antibody-Immunohistochemistry-NBP1-56387-img0003.jpg)
![Immunohistochemistry-Paraffin: PGLS Antibody [NBP1-56387] - Human Colon Tissue, antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14384_PGLS-Antibody-Immunohistochemistry-Paraffin-NBP1-56387-img0002.jpg)