| Name | PGM1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56528 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PGM1(phosphoglucomutase 1) The peptide sequence was selected from the middle region of PGM1 (NP_002624). Peptide sequence ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PGM1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |