EIF3M Antibody
| Name | EIF3M Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56654 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EIF3M(eukaryotic translation initiation factor 3, subunit M) The peptide sequence was selected from the N terminal of EIF3M. Peptide sequence MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | EIF3M |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: EIF3M Antibody [NBP1-56654] - HepG2 cell lysate, Antibody Titration: 1.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19901_EIF3M-Antibody-Western-Blot-NBP1-56654-img0001.jpg)
![Immunohistochemistry-Paraffin: EIF3M Antibody [NBP1-56654] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19902_EIF3M-Antibody-Immunohistochemistry-Paraffin-NBP1-56654-img0002.jpg)