EPB42 Antibody

Name EPB42 Antibody
Supplier Novus Biologicals
Catalog NBP1-56647
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EPB42 (erythrocyte membrane protein band 4.2) The peptide sequence was selected from the middle region of EPB42. Peptide sequence ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EPB42
Conjugate Unconjugated
Supplier Page Shop

Product images