GFPT2 Antibody

Name GFPT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56688
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to GFPT2(glutamine-fructose-6-phosphate transaminase 2) The peptide sequence was selected from the middle region of GFPT2 (NP_005101). Peptide sequence TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GFPT2
Conjugate Unconjugated
Supplier Page Shop

Product images